PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv9_224390_wsiw.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 572aa    MW: 62254.7 Da    PI: 7.453
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv9_224390_wsiw.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.81.8e-11413471563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr++r   NR++A rs +RK  +i eLe kv++L++e ++L  +l  l+  +a l++++
  Bv9_224390_wsiw.t1 413 KRAKRILANRLSAARSKERKMRYISELEHKVQTLQNEATTLSAQLTLLQRDSAGLTTQN 471
                         9************************************************9999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-18409473IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875411474IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11413468No hitNo description
PfamPF001708.5E-10413471IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-10413470No hitNo description
CDDcd147031.11E-24414465No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MGDTERGNID MMHRIQNPFG ALSRTSNHLD VSQLNISQIR PPLPQNSQNL QNSGCENGKR  60
SGIPPSHPTM PPLSPYSQIP VTRPGSQHSG SQNFSRGPSH SRSLSQPAFF MNDSLPPLSP  120
SPYQNSTSPT NGSENANSSN GSLENRDGCG NSLLPPSSFG KSNSLHITEG FPPRKLHRRS  180
ISDIPFGFDN VFQSSPPPTS MVPPSPRGHA GLERTLSGGE FAGSAKPAQL VKKESSWDKT  240
RDGNVEGEVV DDLLSAYMDL DHLDAMNSSG TDEKYGNENR DDIDSRASGS KTNGCESSDN  300
EAESSVNESG SSGQRPMVGE RKRGAAGEAA PTSRHYRSIS MDSFIGNMNF GDESPKLPPS  360
PSTGVAQLSL KDPANGNSNA FSMEFGNGEF TGPELKKIMA NEKLAEIALT DPKRAKRILA  420
NRLSAARSKE RKMRYISELE HKVQTLQNEA TTLSAQLTLL QRDSAGLTTQ NNELKFRLQA  480
MEQQAQLRDA LNEALTAEIH RLKIATGELN AESMSKCFGQ QLYVNPQMYQ QQQQPRSTQN  540
NTNKLQHPGS LQEQPKAQDS NNGKSTKSEL KH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010665860.10.0PREDICTED: uncharacterized protein LOC104883107
TrEMBLA0A0J8B6710.0A0A0J8B671_BETVU; Uncharacterized protein
STRINGVIT_03s0038g00860.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-132bZIP family protein